PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003474-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 1057aa    MW: 115952 Da    PI: 5.0019
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003474-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1694141148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEd ll +av+++ g++Wk+Ia++  k Rt+ qc +rwqk+l
    NNU_003474-RA  94 KGQWTTEEDALLCKAVQKYKGRNWKKIAAECFKDRTDVQCLHRWQKVL 141
                      799*************************99999************986 PP

2Myb_DNA-binding61.91.3e-19147193148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++++v+++G + W+tIa+ ++ gR +kqc++rw+++l
    NNU_003474-RA 147 KGPWSKEEDEIIIELVNKYGAKKWSTIAQALP-GRIGKQCRERWHNHL 193
                      79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15199241145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
    NNU_003474-RA 199 KEAWTQEEELALIQAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 241
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.57889141IPR017930Myb domain
SuperFamilySSF466895.32E-1590147IPR009057Homeodomain-like
SMARTSM007171.7E-1293143IPR001005SANT/Myb domain
PfamPF002491.3E-1394141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-2196154IPR009057Homeodomain-like
CDDcd001675.58E-1297141No hitNo description
PROSITE profilePS5129432.289142197IPR017930Myb domain
SuperFamilySSF466895.75E-32144240IPR009057Homeodomain-like
SMARTSM007171.2E-18146195IPR001005SANT/Myb domain
PfamPF002496.0E-18147193IPR001005SANT/Myb domain
CDDcd001672.69E-16149193No hitNo description
Gene3DG3DSA:1.10.10.603.0E-27155200IPR009057Homeodomain-like
SMARTSM007174.5E-15198246IPR001005SANT/Myb domain
PROSITE profilePS5129419.827198248IPR017930Myb domain
PfamPF002491.2E-13199242IPR001005SANT/Myb domain
CDDcd001671.12E-11201241No hitNo description
Gene3DG3DSA:1.10.10.601.6E-21201248IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1057 aa     Download sequence    Send to blast
MCTESIVSLT SSIQYLHRFS GFCCSKLNTS CPSKRKIWIL FREAYDGTMA TDKTKGARRV  60
EAPVGAPPDG SSESFQKMRP LNGRTSGPTR RSTKGQWTTE EDALLCKAVQ KYKGRNWKKI  120
AAECFKDRTD VQCLHRWQKV LNPELVKGPW SKEEDEIIIE LVNKYGAKKW STIAQALPGR  180
IGKQCRERWH NHLNPAINKE AWTQEEELAL IQAHQIYGNK WAELTKFLPG RTDNAIKNHW  240
NSSVKKKLDS YLASGLLAQF QGLPPVRNPT QCMPSSSMGV QQSNGDKNGP IDRAEAGQIS  300
ECSQGSIAVG CSQSECDMVS NTVSVNAQEN LKPLEESSQR EGQSSNSSCS EPYYVSLEEV  360
QEIHDGVNIS ASSSERNGLQ EVGNSDNKNC KFGSHELSAS FIEVMQESSG FFETSGHCIN  420
GMDENNSMGF NAPSSMENMI VGSNKQENMS IEEGDFGGVS FSGAGMDACF SMENPTTCPN  480
IIDLDGCTDS FLCQSNIQNS ETAGNLVSHS YYPLGSAPLL GGTCCETLLS GPPLLCSAPE  540
LVFGSECNEA SDTPSANQDS ELVTNSCSGF IYPDGSGTSL CNGDTNKVCQ PVEAEHEKET  600
SESLFDSFWD SPSRDDSPDG VLKSAAKSFL CTPSILKKRQ RELLSPLHER KSDKKLERDI  660
NQGLCCTSTL SREFSCLDVM FDDSGSRRAS LSSIEGSLFS PSYCKKKNSG TSDEDKENLE  720
NAFEVRKDGP AFPGRVSEVA SDNSNPKDKI KQRSSNEMTK VNEDIAVQTA SGVLVEHNTN  780
DTVFFSPDRD GHSRKRGLNS VKTPKSQPFR SCDGTFNQSG RLESSSRSRC ISVILSPTVC  840
EKRHEKNLLP DASLQSVPSL NTMELASENA GNGADIESFI MFGDTPATKR GLDSPSAWKS  900
PWFMNSFLPG PRVDTDITIE DIGFLMSPGD RSYDAIGLMR QLSEHTAAAL AEAQEVLSGE  960
NSEIPSKERH SSNQKLAEEN NQFTDYELEN LISLNLAELT LFFQYRFLFY ILMTERRVLD  1020
FSGCGTPGKG AENGKPMAFP SGVSFSSPSS YLMKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-66942486159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-66942486159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9RS480.0B9RS48_RICCO; Myb, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-108myb domain protein 3r-4